Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 840211..840735 | Replicon | chromosome |
| Accession | NZ_LS483304 | ||
| Organism | Staphylococcus hyicus strain NCTC10350 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0A8HRS0 |
| Locus tag | DQL55_RS03835 | Protein ID | WP_037567539.1 |
| Coordinates | 840382..840735 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A0A8HN67 |
| Locus tag | DQL55_RS03830 | Protein ID | WP_039644674.1 |
| Coordinates | 840211..840381 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL55_RS03805 | 836006..836482 | + | 477 | WP_052257801.1 | PH domain-containing protein | - |
| DQL55_RS03810 | 836475..837965 | + | 1491 | WP_039644671.1 | PH domain-containing protein | - |
| DQL55_RS03815 | 837946..838461 | + | 516 | WP_082021528.1 | PH domain-containing protein | - |
| DQL55_RS03820 | 838529..838879 | + | 351 | WP_039644672.1 | holo-ACP synthase | - |
| DQL55_RS03825 | 838979..840127 | + | 1149 | WP_039644673.1 | alanine racemase | - |
| DQL55_RS03830 | 840211..840381 | + | 171 | WP_039644674.1 | hypothetical protein | Antitoxin |
| DQL55_RS03835 | 840382..840735 | + | 354 | WP_037567539.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DQL55_RS03840 | 840794..841798 | + | 1005 | WP_039644675.1 | PP2C family protein-serine/threonine phosphatase | - |
| DQL55_RS03845 | 841879..842205 | + | 327 | WP_039644676.1 | anti-sigma factor antagonist | - |
| DQL55_RS03850 | 842208..842687 | + | 480 | WP_039644678.1 | anti-sigma B factor RsbW | - |
| DQL55_RS03855 | 842662..843432 | + | 771 | WP_039644680.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13103.33 Da Isoelectric Point: 10.3729
>T292238 WP_037567539.1 NZ_LS483304:840382-840735 [Staphylococcus hyicus]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYKLDKDSVILLEQIRT
VDKKRLKEKLTYLSDKKMKEVNAALGISLGLHMNQHK
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKHKYKLDKDSVILLEQIRT
VDKKRLKEKLTYLSDKKMKEVNAALGISLGLHMNQHK
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8HRS0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8HN67 |