Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 765161..765759 | Replicon | chromosome |
Accession | NZ_LS483303 | ||
Organism | Escherichia coli strain NCTC9967 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | DQM88_RS03995 | Protein ID | WP_053270478.1 |
Coordinates | 765382..765759 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | L4J1C0 |
Locus tag | DQM88_RS03990 | Protein ID | WP_001603498.1 |
Coordinates | 765161..765382 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM88_RS03970 | 760167..760715 | + | 549 | WP_076486551.1 | fimbrial protein YehD | - |
DQM88_RS03975 | 760771..761451 | + | 681 | WP_053270475.1 | fimbrial assembly chaperone | - |
DQM88_RS03980 | 761469..763955 | + | 2487 | WP_111738583.1 | fimbria/pilus outer membrane usher protein | - |
DQM88_RS03985 | 763966..764976 | + | 1011 | WP_089615833.1 | fimbrial protein | - |
DQM88_RS03990 | 765161..765382 | + | 222 | WP_001603498.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DQM88_RS03995 | 765382..765759 | + | 378 | WP_053270478.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
DQM88_RS04005 | 765869..766084 | - | 216 | Protein_723 | transposase | - |
DQM88_RS04015 | 766270..767532 | - | 1263 | WP_089634553.1 | integrase arm-type DNA-binding domain-containing protein | - |
DQM88_RS04025 | 767911..768618 | - | 708 | WP_000234514.1 | DUF554 domain-containing protein | - |
DQM88_RS24130 | 768771..768854 | + | 84 | WP_211180506.1 | protein YqgH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 754708..771151 | 16443 | |
- | flank | IS/Tn | - | - | 765803..766084 | 281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13419.20 Da Isoelectric Point: 6.7260
>T292225 WP_053270478.1 NZ_LS483303:765382-765759 [Escherichia coli]
MRHISPEELIAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITGLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
MRHISPEELIAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITGLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|