Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1885267..1886043 | Replicon | chromosome |
Accession | NZ_LS483302 | ||
Organism | Staphylococcus aureus strain NCTC8726 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DQL80_RS09395 | Protein ID | WP_000031108.1 |
Coordinates | 1885267..1885419 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DQL80_RS09400 | Protein ID | WP_001251224.1 |
Coordinates | 1885444..1886043 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQL80_RS09375 | 1881184..1882005 | + | 822 | WP_111680437.1 | RluA family pseudouridine synthase | - |
DQL80_RS09380 | 1882461..1883846 | - | 1386 | WP_111680438.1 | class II fumarate hydratase | - |
DQL80_RS09385 | 1884042..1884437 | - | 396 | WP_000901023.1 | hypothetical protein | - |
DQL80_RS09395 | 1885267..1885419 | - | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DQL80_RS09400 | 1885444..1886043 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DQL80_RS09405 | 1886202..1886672 | - | 471 | WP_111680440.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DQL80_RS09410 | 1886677..1887804 | - | 1128 | WP_000379991.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DQL80_RS09415 | 1887955..1888677 | - | 723 | WP_172452451.1 | ATP-binding cassette domain-containing protein | - |
DQL80_RS09420 | 1888670..1890127 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T292218 WP_000031108.1 NZ_LS483302:c1885419-1885267 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT292218 WP_001251224.1 NZ_LS483302:c1886043-1885444 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|