Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 822452..822929 Replicon chromosome
Accession NZ_LS483302
Organism Staphylococcus aureus strain NCTC8726

Toxin (Protein)


Gene name TsaT Uniprot ID -
Locus tag DQL80_RS04060 Protein ID WP_111680160.1
Coordinates 822452..822640 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DQL80_RS04065 Protein ID WP_001059690.1
Coordinates 822669..822929 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL80_RS04030 818418..818963 + 546 WP_111680157.1 hypothetical protein -
DQL80_RS04035 819304..819990 + 687 WP_111680158.1 thermonuclease family protein -
DQL80_RS04040 820347..820547 + 201 WP_001059082.1 cold-shock protein -
DQL80_RS04045 821043..821261 - 219 WP_111680159.1 hypothetical protein -
DQL80_RS04050 821323..821607 - 285 WP_001004401.1 hypothetical protein -
DQL80_RS04055 821695..822264 - 570 WP_001106662.1 hypothetical protein -
DQL80_RS04060 822452..822640 - 189 WP_111680160.1 hypothetical protein Toxin
DQL80_RS04065 822669..822929 - 261 WP_001059690.1 hypothetical protein Antitoxin
DQL80_RS04070 823270..823473 + 204 WP_000145160.1 sterile alpha motif-like domain-containing protein -
DQL80_RS04075 823470..823706 - 237 WP_000368687.1 hypothetical protein -
DQL80_RS04080 823930..824511 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DQL80_RS04085 824584..825201 - 618 WP_111680161.1 LysE/ArgO family amino acid transporter -
DQL80_RS04090 825289..826935 - 1647 WP_111679979.1 IS1182-like element ISSau3 family transposase -
DQL80_RS04095 827305..827799 - 495 WP_000569881.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 825289..826935 1646


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7094.77 Da        Isoelectric Point: 9.9971

>T292216 WP_111680160.1 NZ_LS483302:c822640-822452 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSVTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT292216 WP_001059690.1 NZ_LS483302:c822929-822669 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References