Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 2047627..2048147 Replicon chromosome
Accession NZ_LS483300
Organism Staphylococcus aureus strain NCTC7485

Toxin (Protein)


Gene name mazF Uniprot ID Q2YUI5
Locus tag DQL62_RS10550 Protein ID WP_000621174.1
Coordinates 2047627..2047980 (-) Length 118 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag DQL62_RS10555 Protein ID WP_000948331.1
Coordinates 2047977..2048147 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQL62_RS10525 2044597..2045367 - 771 WP_001041107.1 RNA polymerase sigma factor SigB -
DQL62_RS10530 2045342..2045821 - 480 WP_001190825.1 anti-sigma B factor RsbW -
DQL62_RS10535 2045823..2046149 - 327 WP_001052491.1 anti-sigma factor antagonist -
DQL62_RS10540 2046268..2047269 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
DQL62_RS10550 2047627..2047980 - 354 WP_000621174.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
DQL62_RS10555 2047977..2048147 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
DQL62_RS10560 2048232..2049380 - 1149 WP_001281138.1 alanine racemase -
DQL62_RS10565 2049446..2049805 - 360 WP_000581197.1 holo-ACP synthase -
DQL62_RS10570 2049809..2050300 - 492 WP_001286981.1 PH domain-containing protein -
DQL62_RS10575 2050293..2051870 - 1578 WP_111725129.1 PH domain-containing protein -
DQL62_RS10580 2051863..2052342 - 480 WP_001287074.1 hypothetical protein -
DQL62_RS10585 2052546..2053106 - 561 WP_001092404.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 118 a.a.        Molecular weight: 13071.28 Da        Isoelectric Point: 10.0474

>T292194 WP_000621174.1 NZ_LS483300:c2047980-2047627 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAH

Download         Length: 354 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT292194 WP_000948331.1 NZ_LS483300:c2048147-2047977 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q2YUI5

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References