Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1874450..1875226 | Replicon | chromosome |
| Accession | NZ_LS483300 | ||
| Organism | Staphylococcus aureus strain NCTC7485 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | DQL62_RS09505 | Protein ID | WP_000031105.1 |
| Coordinates | 1874450..1874602 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | A0A0D1IYN8 |
| Locus tag | DQL62_RS09510 | Protein ID | WP_001251219.1 |
| Coordinates | 1874627..1875226 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL62_RS09485 | 1870716..1871537 | + | 822 | WP_000669372.1 | RluA family pseudouridine synthase | - |
| DQL62_RS09490 | 1871988..1873373 | - | 1386 | WP_045158592.1 | class II fumarate hydratase | - |
| DQL62_RS09495 | 1873569..1873964 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| DQL62_RS09505 | 1874450..1874602 | - | 153 | WP_000031105.1 | hypothetical protein | Toxin |
| DQL62_RS09510 | 1874627..1875226 | - | 600 | WP_001251219.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| DQL62_RS09515 | 1875385..1875855 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| DQL62_RS09520 | 1875860..1876987 | - | 1128 | WP_000379976.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| DQL62_RS09525 | 1877138..1877860 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| DQL62_RS09530 | 1877853..1879310 | - | 1458 | WP_000649895.1 | ABC transporter substrate-binding protein/permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5922.25 Da Isoelectric Point: 3.8849
>T292193 WP_000031105.1 NZ_LS483300:c1874602-1874450 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKDLGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKDLGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22357.50 Da Isoelectric Point: 5.1445
>AT292193 WP_001251219.1 NZ_LS483300:c1875226-1874627 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNIEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|