Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1661034..1661646 | Replicon | chromosome |
Accession | NZ_LS483298 | ||
Organism | Streptococcus pyogenes strain NCTC8225 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A4Z2JY48 |
Locus tag | DQM39_RS08700 | Protein ID | WP_002982731.1 |
Coordinates | 1661311..1661646 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q5X9X9 |
Locus tag | DQM39_RS08695 | Protein ID | WP_002988079.1 |
Coordinates | 1661034..1661321 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM39_RS08670 | 1656224..1657207 | - | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
DQM39_RS08675 | 1657211..1658140 | - | 930 | WP_002982751.1 | tagatose-6-phosphate kinase | - |
DQM39_RS08680 | 1658188..1658703 | - | 516 | WP_111680898.1 | galactose-6-phosphate isomerase subunit LacB | - |
DQM39_RS08685 | 1658738..1659166 | - | 429 | WP_002982747.1 | galactose-6-phosphate isomerase subunit LacA | - |
DQM39_RS08690 | 1659611..1660384 | + | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
DQM39_RS08695 | 1661034..1661321 | + | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
DQM39_RS08700 | 1661311..1661646 | + | 336 | WP_002982731.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DQM39_RS08705 | 1661735..1662767 | + | 1033 | Protein_1615 | site-specific integrase | - |
DQM39_RS08710 | 1662887..1663279 | - | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
DQM39_RS08715 | 1663300..1663746 | - | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
DQM39_RS08720 | 1664039..1665022 | + | 984 | WP_111680899.1 | IS30-like element IS1239 family transposase | - |
DQM39_RS08725 | 1665050..1665256 | - | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
DQM39_RS08730 | 1665253..1665759 | - | 507 | WP_002988070.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13145.88 Da Isoelectric Point: 5.2144
>T292188 WP_002982731.1 NZ_LS483298:1661311-1661646 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKISHYHSTKGYTLSKD
YIVLYHIEGEENRVVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z2JY48 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4U7GX94 |