Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3686890..3687569 | Replicon | chromosome |
| Accession | NZ_LS483297 | ||
| Organism | Escherichia coli strain NCTC11023 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | DQM98_RS19215 | Protein ID | WP_000854680.1 |
| Coordinates | 3687228..3687569 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EWR7 |
| Locus tag | DQM98_RS19210 | Protein ID | WP_000070396.1 |
| Coordinates | 3686890..3687207 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM98_RS19165 | 3682328..3683149 | + | 822 | WP_001548153.1 | DUF945 domain-containing protein | - |
| DQM98_RS19170 | 3683366..3684067 | + | 702 | WP_021553244.1 | WYL domain-containing protein | - |
| DQM98_RS19175 | 3684108..3684344 | + | 237 | WP_001144029.1 | hypothetical protein | - |
| DQM98_RS19180 | 3684344..3684787 | + | 444 | WP_021553245.1 | hypothetical protein | - |
| DQM98_RS19185 | 3684810..3685277 | + | 468 | WP_001385283.1 | hypothetical protein | - |
| DQM98_RS19190 | 3685354..3685593 | + | 240 | Protein_3508 | DUF905 domain-containing protein | - |
| DQM98_RS19195 | 3685691..3686149 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| DQM98_RS19200 | 3686165..3686641 | + | 477 | WP_000811693.1 | RadC family protein | - |
| DQM98_RS19205 | 3686650..3686871 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| DQM98_RS19210 | 3686890..3687207 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| DQM98_RS19215 | 3687228..3687569 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| DQM98_RS19220 | 3688088..3689161 | + | 1074 | WP_057081038.1 | site-specific integrase | - |
| DQM98_RS19225 | 3689172..3690101 | + | 930 | WP_057081037.1 | hypothetical protein | - |
| DQM98_RS19230 | 3690169..3690396 | - | 228 | WP_001403510.1 | hypothetical protein | - |
| DQM98_RS19235 | 3690466..3691851 | - | 1386 | WP_057081036.1 | P-type conjugative transfer protein TrbL | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | gmhA/lpcA | 3660750..3724333 | 63583 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T292185 WP_000854680.1 NZ_LS483297:3687228-3687569 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|