Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3486673..3487510 | Replicon | chromosome |
Accession | NZ_LS483297 | ||
Organism | Escherichia coli strain NCTC11023 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | DQM98_RS18080 | Protein ID | WP_000227784.1 |
Coordinates | 3486968..3487510 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | DQM98_RS18075 | Protein ID | WP_001297137.1 |
Coordinates | 3486673..3486984 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM98_RS18050 | 3481693..3482640 | + | 948 | WP_001239436.1 | cytochrome o ubiquinol oxidase subunit II | - |
DQM98_RS18055 | 3482662..3484653 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
DQM98_RS18060 | 3484643..3485257 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
DQM98_RS18065 | 3485257..3485586 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
DQM98_RS18070 | 3485598..3486488 | + | 891 | WP_000971336.1 | heme o synthase | - |
DQM98_RS18075 | 3486673..3486984 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
DQM98_RS18080 | 3486968..3487510 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
DQM98_RS18085 | 3487566..3488501 | - | 936 | WP_001297127.1 | sel1 repeat family protein | - |
DQM98_RS18090 | 3488909..3490273 | + | 1365 | WP_001000978.1 | MFS transporter | - |
DQM98_RS18095 | 3490401..3490892 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
DQM98_RS18100 | 3491060..3491971 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T292184 WP_000227784.1 NZ_LS483297:3486968-3487510 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|