Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2464848..2465486 | Replicon | chromosome |
Accession | NZ_LS483297 | ||
Organism | Escherichia coli strain NCTC11023 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | DQM98_RS12670 | Protein ID | WP_000813794.1 |
Coordinates | 2465310..2465486 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | DQM98_RS12665 | Protein ID | WP_001270286.1 |
Coordinates | 2464848..2465264 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DQM98_RS12645 | 2460000..2460941 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
DQM98_RS12650 | 2460942..2461955 | - | 1014 | WP_000220393.1 | ABC transporter ATP-binding protein | - |
DQM98_RS12655 | 2461973..2463118 | - | 1146 | WP_000047429.1 | ABC transporter substrate-binding protein | - |
DQM98_RS12660 | 2463360..2464769 | - | 1410 | WP_000760649.1 | PLP-dependent aminotransferase family protein | - |
DQM98_RS12665 | 2464848..2465264 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
DQM98_RS12670 | 2465310..2465486 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
DQM98_RS12675 | 2465708..2465938 | + | 231 | WP_000494244.1 | YncJ family protein | - |
DQM98_RS12680 | 2466030..2467991 | - | 1962 | WP_024179169.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
DQM98_RS12685 | 2468064..2468600 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
DQM98_RS12690 | 2468653..2469882 | + | 1230 | WP_111732518.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2469922..2471070 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T292182 WP_000813794.1 NZ_LS483297:c2465486-2465310 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT292182 WP_001270286.1 NZ_LS483297:c2465264-2464848 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|