Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3761164..3761951 Replicon chromosome
Accession NZ_LS483296
Organism Escherichia coli strain NCTC9966

Toxin (Protein)


Gene name yeeV Uniprot ID A0A377E3D6
Locus tag DQM96_RS19780 Protein ID WP_001194695.1
Coordinates 3761574..3761951 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag DQM96_RS19775 Protein ID WP_040207079.1
Coordinates 3761164..3761523 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DQM96_RS19730 3756853..3757488 + 636 WP_040220404.1 hypothetical protein -
DQM96_RS19735 3757524..3757976 + 453 WP_001020418.1 hypothetical protein -
DQM96_RS19740 3757973..3758422 + 450 WP_040220400.1 hypothetical protein -
DQM96_RS19745 3758499..3758732 + 234 WP_111724753.1 DUF905 domain-containing protein -
DQM96_RS19750 3758852..3759670 + 819 WP_001234406.1 DUF945 domain-containing protein -
DQM96_RS19760 3759937..3760407 + 471 WP_000131762.1 antirestriction protein -
DQM96_RS19765 3760419..3760898 + 480 WP_000437750.1 DNA repair protein RadC -
DQM96_RS19770 3760919..3761140 + 222 WP_000691981.1 DUF987 domain-containing protein -
DQM96_RS19775 3761164..3761523 + 360 WP_040207079.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
DQM96_RS19780 3761574..3761951 + 378 WP_001194695.1 TA system toxin CbtA family protein Toxin
DQM96_RS19785 3761948..3762439 + 492 WP_040220390.1 hypothetical protein -
DQM96_RS19790 3762471..3762674 + 204 WP_000413747.1 DUF957 domain-containing protein -
DQM96_RS19795 3762755..3763606 + 852 WP_001614353.1 DUF4942 domain-containing protein -
DQM96_RS19810 3763937..3764668 - 732 WP_001340895.1 DNA polymerase III subunit epsilon -
DQM96_RS19815 3764733..3765200 + 468 WP_000917883.1 ribonuclease HI -
DQM96_RS19820 3765197..3765919 - 723 WP_001326702.1 class I SAM-dependent methyltransferase -
DQM96_RS19825 3765953..3766708 + 756 WP_001052715.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14180.97 Da        Isoelectric Point: 7.4209

>T292170 WP_001194695.1 NZ_LS483296:3761574-3761951 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13112.99 Da        Isoelectric Point: 7.0259

>AT292170 WP_040207079.1 NZ_LS483296:3761164-3761523 [Escherichia coli]
MSNKIPTVNHDITDPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377E3D6

Antitoxin

Source ID Structure

References