Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3690805..3691484 | Replicon | chromosome |
| Accession | NZ_LS483296 | ||
| Organism | Escherichia coli strain NCTC9966 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | DQM96_RS19345 | Protein ID | WP_000854680.1 |
| Coordinates | 3691143..3691484 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EWR7 |
| Locus tag | DQM96_RS19340 | Protein ID | WP_000070396.1 |
| Coordinates | 3690805..3691122 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM96_RS19295 | 3686243..3687064 | + | 822 | WP_000197387.1 | DUF945 domain-containing protein | - |
| DQM96_RS19300 | 3687281..3687982 | + | 702 | WP_111724748.1 | WYL domain-containing protein | - |
| DQM96_RS19305 | 3688023..3688259 | + | 237 | WP_001144031.1 | hypothetical protein | - |
| DQM96_RS19310 | 3688259..3688702 | + | 444 | WP_000649865.1 | hypothetical protein | - |
| DQM96_RS19315 | 3688725..3689192 | + | 468 | WP_001385283.1 | hypothetical protein | - |
| DQM96_RS19320 | 3689269..3689508 | + | 240 | WP_000194654.1 | DUF905 domain-containing protein | - |
| DQM96_RS19325 | 3689606..3690064 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| DQM96_RS19330 | 3690080..3690556 | + | 477 | WP_000811693.1 | RadC family protein | - |
| DQM96_RS19335 | 3690565..3690786 | + | 222 | WP_001568590.1 | DUF987 domain-containing protein | - |
| DQM96_RS19340 | 3690805..3691122 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| DQM96_RS19345 | 3691143..3691484 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| DQM96_RS19350 | 3692062..3693126 | - | 1065 | Protein_3540 | phosphoribosyl transferase | - |
| DQM96_RS19360 | 3694385..3694552 | - | 168 | Protein_3542 | phosphoribosyl transferase | - |
| DQM96_RS19365 | 3694563..3695543 | - | 981 | WP_001567470.1 | DNA-protecting protein DprA | - |
| DQM96_RS19370 | 3695959..3696231 | - | 273 | WP_001185343.1 | ogr/Delta-like zinc finger family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T292168 WP_000854680.1 NZ_LS483296:3691143-3691484 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|