Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1144478..1145145 | Replicon | chromosome |
| Accession | NZ_LS483296 | ||
| Organism | Escherichia coli strain NCTC9966 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A156PNF2 |
| Locus tag | DQM96_RS05880 | Protein ID | WP_001618791.1 |
| Coordinates | 1144478..1144807 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A156PNH9 |
| Locus tag | DQM96_RS05885 | Protein ID | WP_001618790.1 |
| Coordinates | 1144828..1145145 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQM96_RS05875 | 1139534..1144114 | + | 4581 | WP_111724795.1 | adhesin-like autotransporter YpjA/EhaD | - |
| DQM96_RS05880 | 1144478..1144807 | - | 330 | WP_001618791.1 | TA system toxin CbtA family protein | Toxin |
| DQM96_RS05885 | 1144828..1145145 | - | 318 | WP_001618790.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| DQM96_RS05890 | 1145164..1145385 | - | 222 | WP_044864853.1 | DUF987 domain-containing protein | - |
| DQM96_RS05895 | 1145394..1145870 | - | 477 | WP_000811693.1 | RadC family protein | - |
| DQM96_RS05900 | 1145886..1146344 | - | 459 | WP_000211838.1 | antirestriction protein | - |
| DQM96_RS05905 | 1146442..1146681 | - | 240 | WP_000194654.1 | DUF905 domain-containing protein | - |
| DQM96_RS05910 | 1146758..1147225 | - | 468 | WP_001547765.1 | hypothetical protein | - |
| DQM96_RS05915 | 1147248..1147691 | - | 444 | WP_032199444.1 | hypothetical protein | - |
| DQM96_RS05920 | 1147691..1147927 | - | 237 | WP_001144031.1 | hypothetical protein | - |
| DQM96_RS05925 | 1147968..1148669 | - | 702 | WP_111724571.1 | WYL domain-containing protein | - |
| DQM96_RS05930 | 1148886..1149707 | - | 822 | WP_111724572.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1135533..1176366 | 40833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12509.43 Da Isoelectric Point: 7.2767
>T292160 WP_001618791.1 NZ_LS483296:c1144807-1144478 [Escherichia coli]
MNTLPATTQRAAKPCLSPVAVWKMLLTHLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADTVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTDLLKTNVK
MNTLPATTQRAAKPCLSPVAVWKMLLTHLLEQHYGLTLNDTPFSEERVIQEHIDAGITLADTVNFLVEKYELVRIDRKGF
SWQEQTPYISVVDILRARRSTDLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A156PNF2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A156PNH9 |