Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 763830..764355 | Replicon | chromosome |
Accession | NZ_LS483250 | ||
Organism | Moritella yayanosii strain DB21MT 5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | MORIYA_RS03370 | Protein ID | WP_112712706.1 |
Coordinates | 763830..764117 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | MORIYA_RS03375 | Protein ID | WP_112712708.1 |
Coordinates | 764107..764355 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MORIYA_RS20720 | 758865..759083 | + | 219 | WP_162629222.1 | hypothetical protein | - |
MORIYA_RS03340 | 759089..759478 | - | 390 | WP_112712698.1 | nuclear transport factor 2 family protein | - |
MORIYA_RS20985 | 759887..760102 | + | 216 | WP_197713352.1 | hypothetical protein | - |
MORIYA_RS03350 | 760229..760955 | + | 727 | Protein_648 | transposase | - |
MORIYA_RS03355 | 761309..761800 | + | 492 | WP_112712700.1 | type VI secretion system amidase effector protein Tae4 | - |
MORIYA_RS03360 | 761797..762156 | + | 360 | WP_112712702.1 | hypothetical protein | - |
MORIYA_RS03365 | 762884..763750 | + | 867 | WP_112712704.1 | AraC family transcriptional regulator | - |
MORIYA_RS03370 | 763830..764117 | - | 288 | WP_112712706.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MORIYA_RS03375 | 764107..764355 | - | 249 | WP_112712708.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MORIYA_RS03380 | 764763..765140 | - | 378 | Protein_654 | IS110 family transposase | - |
MORIYA_RS03390 | 766257..766730 | - | 474 | Protein_655 | MmgE/PrpD family protein | - |
MORIYA_RS03395 | 766882..768222 | - | 1341 | Protein_656 | YdiU family protein | - |
MORIYA_RS03400 | 768346..768993 | - | 648 | WP_112712710.1 | NifU family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 761797..770233 | 8436 | |
- | flank | IS/Tn | - | - | 760340..760675 | 335 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10836.68 Da Isoelectric Point: 10.4697
>T292129 WP_112712706.1 NZ_LS483250:c764117-763830 [Moritella yayanosii]
MTYELEFKKSALKEWKKLGATIQSQFKKKLTDILSNPHIESAKLSGGNELYKIKLRQVGYRLVYEVNDTVVTVTVISVGK
RDKGKIYTAAMNRIN
MTYELEFKKSALKEWKKLGATIQSQFKKKLTDILSNPHIESAKLSGGNELYKIKLRQVGYRLVYEVNDTVVTVTVISVGK
RDKGKIYTAAMNRIN
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|