Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1214919..1215538 Replicon chromosome
Accession NZ_LS399318
Organism Klebsiella pneumoniae isolate CNR48

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag CNR480_RS05905 Protein ID WP_002892050.1
Coordinates 1215320..1215538 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag CNR480_RS05900 Protein ID WP_002892066.1
Coordinates 1214919..1215293 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CNR480_RS05890 1210071..1211264 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
CNR480_RS05895 1211287..1214433 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
CNR480_RS05900 1214919..1215293 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
CNR480_RS05905 1215320..1215538 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
CNR480_RS05910 1215701..1216267 + 567 WP_002892030.1 maltose O-acetyltransferase -
CNR480_RS05915 1216239..1216379 - 141 WP_004147370.1 hypothetical protein -
CNR480_RS05920 1216400..1216870 + 471 WP_040182126.1 YlaC family protein -
CNR480_RS05925 1216845..1218296 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
CNR480_RS05930 1218397..1219095 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
CNR480_RS05935 1219092..1219232 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
CNR480_RS05940 1219232..1219495 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T292116 WP_002892050.1 NZ_LS399318:1215320-1215538 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT292116 WP_002892066.1 NZ_LS399318:1214919-1215293 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References