Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3990137..3990803 | Replicon | chromosome |
Accession | NZ_LR994655 | ||
Organism | Serratia sp. Tan611 isolate Serratia sp. Tan611 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | TAN611_RS18820 | Protein ID | WP_105232394.1 |
Coordinates | 3990137..3990556 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | TAN611_RS18825 | Protein ID | WP_105232395.1 |
Coordinates | 3990537..3990803 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TAN611_RS18800 | 3986110..3987840 | - | 1731 | WP_105232391.1 | single-stranded-DNA-specific exonuclease RecJ | - |
TAN611_RS18805 | 3987853..3988569 | - | 717 | WP_015673664.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
TAN611_RS18810 | 3988597..3989496 | - | 900 | WP_105232392.1 | site-specific tyrosine recombinase XerD | - |
TAN611_RS18815 | 3989588..3990106 | + | 519 | WP_105232393.1 | flavodoxin FldB | - |
TAN611_RS18820 | 3990137..3990556 | - | 420 | WP_105232394.1 | hypothetical protein | Toxin |
TAN611_RS18825 | 3990537..3990803 | - | 267 | WP_105232395.1 | FAD assembly factor SdhE | Antitoxin |
TAN611_RS18830 | 3991134..3992126 | + | 993 | WP_105232396.1 | tRNA-modifying protein YgfZ | - |
TAN611_RS18835 | 3992163..3992843 | - | 681 | WP_105232397.1 | hemolysin III family protein | - |
TAN611_RS18840 | 3993038..3993646 | + | 609 | WP_105232398.1 | HD domain-containing protein | - |
TAN611_RS18845 | 3993680..3994999 | - | 1320 | WP_105232399.1 | MHS family MFS transporter | - |
TAN611_RS18850 | 3994996..3995649 | - | 654 | WP_203066869.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16481.54 Da Isoelectric Point: 11.5037
>T292105 WP_105232394.1 NZ_LR994655:c3990556-3990137 [Serratia sp. Tan611]
VAQWRCDVRISWRTQLISLLAHGALILLILISPWPESYDPVWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLVRRPWMLRYGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRMRLVKDESEG
VAQWRCDVRISWRTQLISLLAHGALILLILISPWPESYDPVWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLVRRPWMLRYGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRMRLVKDESEG
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|