Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4817926..4818593 | Replicon | chromosome |
Accession | NZ_LR994544 | ||
Organism | Xanthomonas euroxanthea isolate X. euroxanthea CPBF 424 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | XTG_RS20260 | Protein ID | WP_104627459.1 |
Coordinates | 4818177..4818593 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | XTG_RS20255 | Protein ID | WP_102582218.1 |
Coordinates | 4817926..4818180 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XTG_RS20230 | 4813380..4814219 | + | 840 | WP_115678178.1 | SDR family oxidoreductase | - |
XTG_RS20235 | 4814370..4815635 | + | 1266 | WP_164739333.1 | cardiolipin synthase B | - |
XTG_RS20240 | 4815678..4816214 | - | 537 | WP_115678179.1 | hypothetical protein | - |
XTG_RS20245 | 4816483..4816689 | + | 207 | WP_104586339.1 | hypothetical protein | - |
XTG_RS20250 | 4816676..4817788 | + | 1113 | WP_115678180.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
XTG_RS20255 | 4817926..4818180 | + | 255 | WP_102582218.1 | Arc family DNA-binding protein | Antitoxin |
XTG_RS20260 | 4818177..4818593 | + | 417 | WP_104627459.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
XTG_RS20265 | 4818719..4819279 | - | 561 | WP_115678181.1 | hypothetical protein | - |
XTG_RS20270 | 4820049..4820342 | + | 294 | WP_104586333.1 | hypothetical protein | - |
XTG_RS20275 | 4820329..4820781 | - | 453 | WP_181901322.1 | hypothetical protein | - |
XTG_RS20280 | 4821124..4821291 | + | 168 | WP_164739645.1 | hypothetical protein | - |
XTG_RS20285 | 4821767..4823392 | + | 1626 | WP_115678182.1 | enterochelin esterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14770.04 Da Isoelectric Point: 5.6845
>T292099 WP_104627459.1 NZ_LR994544:4818177-4818593 [Xanthomonas euroxanthea]
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRYGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRYGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|