Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 851466..851990 Replicon chromosome
Accession NZ_LR962863
Organism Staphylococcus schleiferi strain NCTC12218

Toxin (Protein)


Gene name mazF Uniprot ID S2X8B9
Locus tag JM183_RS03845 Protein ID WP_016426488.1
Coordinates 851637..851990 (+) Length 118 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID S2XCM0
Locus tag JM183_RS03840 Protein ID WP_016426487.1
Coordinates 851466..851636 (+) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JM183_RS03810 (NCTC12218_00811) 847393..847821 + 429 WP_167512901.1 PH domain-containing protein -
JM183_RS03815 (NCTC12218_00812) 847814..848173 + 360 WP_236744740.1 PH domain-containing protein -
JM183_RS03820 (NCTC12218_00813) 848202..849329 + 1128 WP_236744741.1 PH domain-containing protein -
JM183_RS03825 (NCTC12218_00814) 849313..849834 + 522 WP_126496614.1 PH domain-containing protein -
JM183_RS03830 (NCTC12218_00815) 849831..850187 + 357 WP_016426485.1 holo-ACP synthase -
JM183_RS03835 (NCTC12218_00816) 850232..851380 + 1149 WP_126496615.1 alanine racemase -
JM183_RS03840 (NCTC12218_00817) 851466..851636 + 171 WP_016426487.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
JM183_RS03845 (NCTC12218_00818) 851637..851990 + 354 WP_016426488.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
JM183_RS03850 (NCTC12218_00819) 852049..853053 + 1005 WP_016426489.1 PP2C family protein-serine/threonine phosphatase -
JM183_RS03855 (NCTC12218_00820) 853132..853458 + 327 WP_016426490.1 anti-sigma factor antagonist -
JM183_RS03860 (NCTC12218_00821) 853460..853939 + 480 WP_016426491.1 anti-sigma B factor RsbW -
JM183_RS03865 (NCTC12218_00822) 853914..854684 + 771 WP_236744742.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 118 a.a.        Molecular weight: 13157.33 Da        Isoelectric Point: 10.1660

>T292094 WP_016426488.1 NZ_LR962863:851637-851990 [Staphylococcus schleiferi]
MKRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKNKYKLDKDSVILLEQIRT
VDKKRLKEKLTFLSEEKMKEVNYALGISLGLNMNHHK

Download         Length: 354 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6370.00 Da        Isoelectric Point: 3.9760

>AT292094 WP_016426487.1 NZ_LR962863:851466-851636 [Staphylococcus schleiferi]
MSAFNQTRFKNLEQSLKEGYVQMADLNLSLATEAYSVECEACDCNESHLLSDYKDD

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S2X8B9

Antitoxin

Source ID Structure
AlphaFold DB S2XCM0

References