Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4630494..4631089 | Replicon | chromosome |
| Accession | NZ_LR898874 | ||
| Organism | Escherichia coli isolate MSB1_4I-sc-2280412 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9XNP6 |
| Locus tag | JMX41_RS23110 | Protein ID | WP_000239577.1 |
| Coordinates | 4630494..4630844 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | JMX41_RS23115 | Protein ID | WP_001223208.1 |
| Coordinates | 4630838..4631089 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX41_RS23090 | 4625943..4626965 | - | 1023 | WP_001572298.1 | ABC transporter permease | - |
| JMX41_RS23095 | 4626979..4628481 | - | 1503 | WP_000205813.1 | sugar ABC transporter ATP-binding protein | - |
| JMX41_RS23100 | 4628621..4629577 | - | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| JMX41_RS23105 | 4629887..4630417 | + | 531 | WP_000055070.1 | inorganic diphosphatase | - |
| JMX41_RS23110 | 4630494..4630844 | - | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
| JMX41_RS23115 | 4630838..4631089 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| JMX41_RS23120 | 4631301..4631642 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| JMX41_RS23125 | 4631645..4635424 | - | 3780 | WP_001572297.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T292083 WP_000239577.1 NZ_LR898874:c4630844-4630494 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XNP6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |