Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4341756..4342306 Replicon chromosome
Accession NZ_LR898874
Organism Escherichia coli isolate MSB1_4I-sc-2280412

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag JMX41_RS21680 Protein ID WP_001160966.1
Coordinates 4341756..4342070 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag JMX41_RS21685 Protein ID WP_000125568.1
Coordinates 4342073..4342306 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX41_RS21655 4337431..4338717 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
JMX41_RS21660 4338717..4339706 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
JMX41_RS21665 4339703..4340524 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
JMX41_RS21670 4340527..4340904 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
JMX41_RS21675 4340911..4341759 + 849 WP_001570924.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
JMX41_RS21680 4341756..4342070 - 315 WP_001160966.1 CcdB family protein Toxin
JMX41_RS21685 4342073..4342306 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
JMX41_RS21690 4342392..4342871 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
JMX41_RS21695 4343063..4344925 - 1863 WP_000377117.1 glutathione-regulated potassium-efflux system protein KefC -
JMX41_RS21700 4344918..4345448 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
JMX41_RS21705 4345556..4346887 - 1332 WP_001183201.1 MFS transporter -
JMX41_RS21710 4346946..4347233 - 288 WP_001570923.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T292081 WP_001160966.1 NZ_LR898874:c4342070-4341756 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT292081 WP_000125568.1 NZ_LR898874:c4342306-4342073 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References