Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3946943..3947780 | Replicon | chromosome |
Accession | NZ_LR898874 | ||
Organism | Escherichia coli isolate MSB1_4I-sc-2280412 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | V0SED1 |
Locus tag | JMX41_RS19710 | Protein ID | WP_000227787.1 |
Coordinates | 3947238..3947780 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | B1LJI1 |
Locus tag | JMX41_RS19705 | Protein ID | WP_001353405.1 |
Coordinates | 3946943..3947254 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX41_RS19680 | 3941963..3942910 | + | 948 | WP_001571023.1 | cytochrome o ubiquinol oxidase subunit II | - |
JMX41_RS19685 | 3942932..3944923 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
JMX41_RS19690 | 3944913..3945527 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JMX41_RS19695 | 3945527..3945856 | + | 330 | WP_000019803.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JMX41_RS19700 | 3945868..3946758 | + | 891 | WP_000971328.1 | heme o synthase | - |
JMX41_RS19705 | 3946943..3947254 | + | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
JMX41_RS19710 | 3947238..3947780 | + | 543 | WP_000227787.1 | GNAT family N-acetyltransferase | Toxin |
JMX41_RS19715 | 3947836..3948771 | - | 936 | WP_001571021.1 | sel1 repeat family protein | - |
JMX41_RS19720 | 3949178..3950542 | + | 1365 | WP_001000966.1 | MFS transporter | - |
JMX41_RS19725 | 3950670..3951161 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
JMX41_RS19730 | 3951329..3952240 | + | 912 | WP_001571020.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19946.24 Da Isoelectric Point: 8.8951
>T292078 WP_000227787.1 NZ_LR898874:3947238-3947780 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829GE43 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G7G3 |