Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3912071..3912689 | Replicon | chromosome |
Accession | NZ_LR898874 | ||
Organism | Escherichia coli isolate MSB1_4I-sc-2280412 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | JMX41_RS19535 | Protein ID | WP_001291435.1 |
Coordinates | 3912471..3912689 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | JMX41_RS19530 | Protein ID | WP_000344800.1 |
Coordinates | 3912071..3912445 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX41_RS19520 | 3907161..3908354 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMX41_RS19525 | 3908377..3911526 | + | 3150 | WP_001132480.1 | multidrug efflux RND transporter permease subunit | - |
JMX41_RS19530 | 3912071..3912445 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
JMX41_RS19535 | 3912471..3912689 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
JMX41_RS19540 | 3912861..3913412 | + | 552 | WP_001571034.1 | maltose O-acetyltransferase | - |
JMX41_RS19545 | 3913528..3913998 | + | 471 | WP_000136192.1 | YlaC family protein | - |
JMX41_RS19550 | 3914162..3915712 | + | 1551 | WP_001571032.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
JMX41_RS19555 | 3915753..3916106 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
JMX41_RS19565 | 3916485..3916796 | + | 312 | WP_000409911.1 | MGMT family protein | - |
JMX41_RS19570 | 3916827..3917399 | - | 573 | WP_000779836.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T292077 WP_001291435.1 NZ_LR898874:3912471-3912689 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT292077 WP_000344800.1 NZ_LR898874:3912071-3912445 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |