Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3448087..3448792 | Replicon | chromosome |
Accession | NZ_LR898874 | ||
Organism | Escherichia coli isolate MSB1_4I-sc-2280412 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | JMX41_RS17305 | Protein ID | WP_000539521.1 |
Coordinates | 3448087..3448473 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JMX41_RS17310 | Protein ID | WP_001280945.1 |
Coordinates | 3448463..3448792 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX41_RS17285 | 3444091..3444717 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
JMX41_RS17290 | 3444714..3445829 | - | 1116 | WP_000555050.1 | aldose sugar dehydrogenase YliI | - |
JMX41_RS17295 | 3445940..3446323 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
JMX41_RS17300 | 3446536..3447861 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
JMX41_RS17305 | 3448087..3448473 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX41_RS17310 | 3448463..3448792 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
JMX41_RS17315 | 3448862..3450190 | - | 1329 | WP_000086871.1 | GGDEF domain-containing protein | - |
JMX41_RS17320 | 3450198..3452546 | - | 2349 | WP_001571164.1 | EAL domain-containing protein | - |
JMX41_RS17325 | 3452724..3453635 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T292076 WP_000539521.1 NZ_LR898874:3448087-3448473 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|