Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2659502..2660028 | Replicon | chromosome |
Accession | NZ_LR898874 | ||
Organism | Escherichia coli isolate MSB1_4I-sc-2280412 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | JMX41_RS13035 | Protein ID | WP_000323025.1 |
Coordinates | 2659502..2659789 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | JMX41_RS13040 | Protein ID | WP_000534858.1 |
Coordinates | 2659789..2660028 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX41_RS12990 | 2654526..2654741 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
JMX41_RS12995 | 2655495..2655710 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
JMX41_RS13000 | 2656011..2656223 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
JMX41_RS13005 | 2656278..2656367 | + | 90 | WP_120795389.1 | hypothetical protein | - |
JMX41_RS13010 | 2656645..2657397 | - | 753 | WP_001571462.1 | antitermination protein | - |
JMX41_RS13015 | 2657411..2658460 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
JMX41_RS13020 | 2658462..2658740 | - | 279 | WP_032147666.1 | hypothetical protein | - |
JMX41_RS13025 | 2658807..2659058 | - | 252 | WP_000980994.1 | hypothetical protein | - |
JMX41_RS13030 | 2659275..2659430 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
JMX41_RS13035 | 2659502..2659789 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
JMX41_RS13040 | 2659789..2660028 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
JMX41_RS13045 | 2660053..2660358 | + | 306 | WP_001326990.1 | hypothetical protein | - |
JMX41_RS13050 | 2660561..2660893 | + | 333 | WP_001301033.1 | protein FlxA | - |
JMX41_RS13055 | 2661330..2662643 | - | 1314 | WP_001571463.1 | ISNCY family transposase | - |
JMX41_RS13060 | 2663412..2663698 | - | 287 | Protein_2565 | hypothetical protein | - |
JMX41_RS13065 | 2664309..2664665 | - | 357 | WP_001310834.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2629105..2675512 | 46407 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T292069 WP_000323025.1 NZ_LR898874:c2659789-2659502 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|