Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1140788..1141371 | Replicon | chromosome |
Accession | NZ_LR898874 | ||
Organism | Escherichia coli isolate MSB1_4I-sc-2280412 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | D8A488 |
Locus tag | JMX41_RS05620 | Protein ID | WP_000254734.1 |
Coordinates | 1141036..1141371 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A376LU34 |
Locus tag | JMX41_RS05615 | Protein ID | WP_001571822.1 |
Coordinates | 1140788..1141036 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX41_RS05605 | 1137127..1138428 | + | 1302 | WP_001571823.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
JMX41_RS05610 | 1138476..1140710 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
JMX41_RS05615 | 1140788..1141036 | + | 249 | WP_001571822.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
JMX41_RS05620 | 1141036..1141371 | + | 336 | WP_000254734.1 | endoribonuclease MazF | Toxin |
JMX41_RS05625 | 1141443..1142234 | + | 792 | WP_001071655.1 | nucleoside triphosphate pyrophosphohydrolase | - |
JMX41_RS05630 | 1142462..1144099 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
JMX41_RS05635 | 1144186..1145484 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1145610..1146938 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12195.20 Da Isoelectric Point: 8.7218
>T292059 WP_000254734.1 NZ_LR898874:1141036-1141371 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGVTKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGVTKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FR63 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A376LU34 |