Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1022650..1023304 | Replicon | chromosome |
| Accession | NZ_LR898874 | ||
| Organism | Escherichia coli isolate MSB1_4I-sc-2280412 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | JMX41_RS05035 | Protein ID | WP_000244781.1 |
| Coordinates | 1022897..1023304 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | JMX41_RS05030 | Protein ID | WP_000354046.1 |
| Coordinates | 1022650..1022916 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX41_RS05010 | 1018739..1020172 | - | 1434 | WP_001571859.1 | 6-phospho-beta-glucosidase BglA | - |
| JMX41_RS05015 | 1020217..1020528 | + | 312 | WP_001182939.1 | N(4)-acetylcytidine aminohydrolase | - |
| JMX41_RS05020 | 1020692..1021351 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| JMX41_RS05025 | 1021428..1022408 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| JMX41_RS05030 | 1022650..1022916 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| JMX41_RS05035 | 1022897..1023304 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| JMX41_RS05040 | 1023344..1023865 | - | 522 | WP_001571858.1 | flavodoxin FldB | - |
| JMX41_RS05045 | 1023977..1024873 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| JMX41_RS05050 | 1024898..1025608 | + | 711 | WP_000715219.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JMX41_RS05055 | 1025614..1027347 | + | 1734 | WP_000813179.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T292058 WP_000244781.1 NZ_LR898874:1022897-1023304 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|