Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3384534..3385152 | Replicon | chromosome |
Accession | NZ_LR898868 | ||
Organism | Escherichia coli isolate MSB1_1D-sc-2280324 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | JMX26_RS16365 | Protein ID | WP_001291435.1 |
Coordinates | 3384934..3385152 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | JMX26_RS16360 | Protein ID | WP_000344800.1 |
Coordinates | 3384534..3384908 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX26_RS16350 | 3379623..3380816 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMX26_RS16355 | 3380839..3383988 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
JMX26_RS16360 | 3384534..3384908 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
JMX26_RS16365 | 3384934..3385152 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
JMX26_RS16370 | 3385324..3385875 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
JMX26_RS16375 | 3385991..3386461 | + | 471 | WP_000136192.1 | YlaC family protein | - |
JMX26_RS16380 | 3386625..3388175 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
JMX26_RS16385 | 3388217..3388570 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
JMX26_RS16395 | 3388949..3389260 | + | 312 | WP_162000861.1 | MGMT family protein | - |
JMX26_RS16400 | 3389291..3389863 | - | 573 | WP_063117855.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T292044 WP_001291435.1 NZ_LR898868:3384934-3385152 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT292044 WP_000344800.1 NZ_LR898868:3384534-3384908 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |