Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2349676..2350314 | Replicon | chromosome |
| Accession | NZ_LR898868 | ||
| Organism | Escherichia coli isolate MSB1_1D-sc-2280324 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | JMX26_RS11360 | Protein ID | WP_000813794.1 |
| Coordinates | 2350138..2350314 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | JMX26_RS11355 | Protein ID | WP_001270286.1 |
| Coordinates | 2349676..2350092 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX26_RS11335 | 2344828..2345769 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| JMX26_RS11340 | 2345770..2346783 | - | 1014 | WP_113418672.1 | ABC transporter ATP-binding protein | - |
| JMX26_RS11345 | 2346801..2347946 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| JMX26_RS11350 | 2348191..2349597 | - | 1407 | WP_113418670.1 | PLP-dependent aminotransferase family protein | - |
| JMX26_RS11355 | 2349676..2350092 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| JMX26_RS11360 | 2350138..2350314 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| JMX26_RS11365 | 2350536..2350766 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| JMX26_RS11370 | 2350858..2352819 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| JMX26_RS11375 | 2352892..2353428 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| JMX26_RS11380 | 2353481..2354695 | + | 1215 | WP_071597387.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2354735..2356000 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T292043 WP_000813794.1 NZ_LR898868:c2350314-2350138 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT292043 WP_001270286.1 NZ_LR898868:c2350092-2349676 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|