Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5319071..5319679 | Replicon | chromosome |
Accession | NZ_LR898867 | ||
Organism | Pseudomonas aeruginosa isolate MINF_3A-sc-2280432 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | JMX72_RS24975 | Protein ID | WP_019486378.1 |
Coordinates | 5319071..5319418 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | JMX72_RS24980 | Protein ID | WP_003114155.1 |
Coordinates | 5319428..5319679 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX72_RS24955 | 5314097..5315128 | + | 1032 | WP_003158906.1 | AAA family ATPase | - |
JMX72_RS24960 | 5315106..5317616 | + | 2511 | WP_003160813.1 | S8 family peptidase | - |
JMX72_RS24965 | 5317715..5318020 | - | 306 | WP_003158903.1 | helix-turn-helix domain-containing protein | - |
JMX72_RS24970 | 5318142..5318783 | + | 642 | WP_003158902.1 | substrate-binding domain-containing protein | - |
JMX72_RS24975 | 5319071..5319418 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX72_RS24980 | 5319428..5319679 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JMX72_RS24985 | 5319893..5320876 | - | 984 | WP_033990852.1 | tyrosine-type recombinase/integrase | - |
JMX72_RS24990 | 5320876..5322168 | - | 1293 | WP_033990854.1 | hypothetical protein | - |
JMX72_RS24995 | 5322398..5323672 | - | 1275 | WP_033990855.1 | zonular occludens toxin family protein | - |
JMX72_RS25000 | 5323676..5324032 | - | 357 | WP_003114150.1 | DUF2523 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | ere(A) / floR / tet(G) / aph(6)-Id / aph(3'')-Ib / blaCARB-2 / sul1 | - | 5227934..5331597 | 103663 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T292030 WP_019486378.1 NZ_LR898867:c5319418-5319071 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |