Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 152123..152628 Replicon chromosome
Accession NZ_LR898867
Organism Pseudomonas aeruginosa isolate MINF_3A-sc-2280432

Toxin (Protein)


Gene name parE Uniprot ID A0A3S3VVC5
Locus tag JMX72_RS00705 Protein ID WP_031640969.1
Coordinates 152123..152404 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag JMX72_RS00710 Protein ID WP_003083775.1
Coordinates 152401..152628 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX72_RS00680 147374..148723 + 1350 WP_003137006.1 C4-dicarboxylate transporter DctA -
JMX72_RS00685 148772..149458 + 687 WP_003083762.1 FadR family transcriptional regulator -
JMX72_RS00690 149559..150293 + 735 WP_003128333.1 GntR family transcriptional regulator -
JMX72_RS00695 150497..150883 + 387 WP_003083767.1 aegerolysin family protein -
JMX72_RS00700 150915..151823 - 909 WP_033990895.1 LysR family transcriptional regulator -
JMX72_RS00705 152123..152404 - 282 WP_031640969.1 type II toxin-antitoxin system toxin ParE Toxin
JMX72_RS00710 152401..152628 - 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
JMX72_RS00715 152804..153424 - 621 WP_003101226.1 hypothetical protein -
JMX72_RS00720 153525..154025 + 501 WP_003101228.1 LEA type 2 family protein -
JMX72_RS00725 154097..154438 + 342 WP_003101229.1 alkylphosphonate utilization protein -
JMX72_RS00730 154520..155947 - 1428 WP_003083784.1 GABA permease -
JMX72_RS00735 156116..157609 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10475.19 Da        Isoelectric Point: 10.0435

>T292025 WP_031640969.1 NZ_LR898867:c152404-152123 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLNLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT292025 WP_003083775.1 NZ_LR898867:c152628-152401 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S3VVC5

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References