Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 152123..152628 | Replicon | chromosome |
| Accession | NZ_LR898867 | ||
| Organism | Pseudomonas aeruginosa isolate MINF_3A-sc-2280432 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A3S3VVC5 |
| Locus tag | JMX72_RS00705 | Protein ID | WP_031640969.1 |
| Coordinates | 152123..152404 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | JMX72_RS00710 | Protein ID | WP_003083775.1 |
| Coordinates | 152401..152628 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX72_RS00680 | 147374..148723 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
| JMX72_RS00685 | 148772..149458 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
| JMX72_RS00690 | 149559..150293 | + | 735 | WP_003128333.1 | GntR family transcriptional regulator | - |
| JMX72_RS00695 | 150497..150883 | + | 387 | WP_003083767.1 | aegerolysin family protein | - |
| JMX72_RS00700 | 150915..151823 | - | 909 | WP_033990895.1 | LysR family transcriptional regulator | - |
| JMX72_RS00705 | 152123..152404 | - | 282 | WP_031640969.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| JMX72_RS00710 | 152401..152628 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| JMX72_RS00715 | 152804..153424 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| JMX72_RS00720 | 153525..154025 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| JMX72_RS00725 | 154097..154438 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
| JMX72_RS00730 | 154520..155947 | - | 1428 | WP_003083784.1 | GABA permease | - |
| JMX72_RS00735 | 156116..157609 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10475.19 Da Isoelectric Point: 10.0435
>T292025 WP_031640969.1 NZ_LR898867:c152404-152123 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLNLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLNLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S3VVC5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C7BDS9 |