Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 114998..115641 | Replicon | plasmid 2 |
Accession | NZ_LR890752 | ||
Organism | Klebsiella pneumoniae isolate KSB1_8C-sc-2280241 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | JMW25_RS26215 | Protein ID | WP_048298725.1 |
Coordinates | 114998..115414 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | JMW25_RS26220 | Protein ID | WP_001261276.1 |
Coordinates | 115411..115641 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW25_RS26200 | 110488..111456 | - | 969 | WP_201515199.1 | IS5 family transposase | - |
JMW25_RS26205 | 111718..113241 | - | 1524 | WP_117282697.1 | EAL domain-containing protein | - |
JMW25_RS26215 | 114998..115414 | - | 417 | WP_048298725.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMW25_RS26220 | 115411..115641 | - | 231 | WP_001261276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
JMW25_RS26225 | 115894..118470 | - | 2577 | WP_053067542.1 | EstP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..174054 | 174054 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15094.58 Da Isoelectric Point: 8.5403
>T292024 WP_048298725.1 NZ_LR890752:c115414-114998 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|