Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 20263..21173 | Replicon | plasmid 2 |
Accession | NZ_LR890752 | ||
Organism | Klebsiella pneumoniae isolate KSB1_8C-sc-2280241 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | JMW25_RS25755 | Protein ID | WP_032413375.1 |
Coordinates | 20703..21173 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A7H4PRG4 |
Locus tag | JMW25_RS25750 | Protein ID | WP_032413443.1 |
Coordinates | 20263..20706 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW25_RS25715 | 16097..17095 | + | 999 | WP_032413381.1 | N(2)-acetyl-L-2,4-diaminobutanoate deacetylase DoeB | - |
JMW25_RS25720 | 17142..18320 | + | 1179 | WP_032413379.1 | cystathionine gamma-synthase family protein | - |
JMW25_RS25725 | 18457..18804 | + | 348 | WP_032413377.1 | hypothetical protein | - |
JMW25_RS25730 | 18862..18987 | + | 126 | Protein_19 | transposase | - |
JMW25_RS25735 | 19121..19345 | - | 225 | Protein_20 | transposase | - |
JMW25_RS25740 | 19365..19550 | + | 186 | WP_071571073.1 | DUF2188 domain-containing protein | - |
JMW25_RS25745 | 19651..20163 | + | 513 | Protein_22 | DUF4113 domain-containing protein | - |
JMW25_RS25750 | 20263..20706 | + | 444 | WP_032413443.1 | DUF2384 domain-containing protein | Antitoxin |
JMW25_RS25755 | 20703..21173 | + | 471 | WP_032413375.1 | RES family NAD+ phosphorylase | Toxin |
JMW25_RS25760 | 21283..21543 | - | 261 | WP_017901409.1 | hypothetical protein | - |
JMW25_RS25765 | 22115..22492 | - | 378 | Protein_26 | transposase | - |
JMW25_RS25770 | 22626..23594 | + | 969 | WP_162887377.1 | IS5 family transposase | - |
JMW25_RS25775 | 23829..25562 | - | 1734 | WP_004118832.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..174054 | 174054 | |
- | inside | IScluster/Tn | - | - | 18832..23594 | 4762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17547.79 Da Isoelectric Point: 4.5152
>T292023 WP_032413375.1 NZ_LR890752:20703-21173 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIAFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIAFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16508.82 Da Isoelectric Point: 10.3013
>AT292023 WP_032413443.1 NZ_LR890752:20263-20706 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDREAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|