Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6915..7552 Replicon plasmid 4
Accession NZ_LR890738
Organism Klebsiella pneumoniae isolate INF323-sc-2280125

Toxin (Protein)


Gene name vagD Uniprot ID A0A4P0XKT8
Locus tag JMX74_RS27965 Protein ID WP_032426501.1
Coordinates 7142..7552 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A4P0XIS7
Locus tag JMX74_RS27960 Protein ID WP_020805477.1
Coordinates 6915..7145 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX74_RS27925 2257..2436 + 180 WP_006788217.1 hypothetical protein -
JMX74_RS27930 2884..3678 - 795 WP_094320137.1 site-specific integrase -
JMX74_RS27935 3876..4892 - 1017 WP_114426085.1 hypothetical protein -
JMX74_RS27940 4889..5212 - 324 WP_004197641.1 hypothetical protein -
JMX74_RS27945 5239..5634 - 396 WP_017899885.1 hypothetical protein -
JMX74_RS27950 5802..6107 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
JMX74_RS27955 6109..6327 - 219 WP_004197642.1 type II toxin-antitoxin system antitoxin CcdA -
JMX74_RS27960 6915..7145 + 231 WP_020805477.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JMX74_RS27965 7142..7552 + 411 WP_032426501.1 PIN domain-containing protein Toxin
JMX74_RS27970 7703..8092 - 390 WP_020805483.1 DUF190 domain-containing protein -
JMX74_RS27975 8089..9462 - 1374 WP_020805486.1 voltage-gated chloride channel family protein -
JMX74_RS27980 9804..10382 - 579 WP_032426503.1 phosphatase PAP2 family protein -
JMX74_RS27985 10703..11665 + 963 WP_032426505.1 manganese-dependent inorganic pyrophosphatase -
JMX74_RS27990 11669..12097 + 429 WP_020805479.1 universal stress protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..129925 129925


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-127)

Antitoxin

SpoVT-AbrB domain

(7-44)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14346.31 Da        Isoelectric Point: 5.1082

>T292009 WP_032426501.1 NZ_LR890738:7142-7552 [Klebsiella pneumoniae]
VNRTYMLDTRLCAFIMREQPEAVLGRLEQAVLRGHHIVISAVTWAELSQAARASGPATQALADAFCASLDTVLPWDRAAA
DATTDIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTRNGGEFERVPGLVLEDWSG

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8591.70 Da        Isoelectric Point: 5.1231

>AT292009 WP_020805477.1 NZ_LR890738:6915-7145 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELESVREGDRIILRPVRPTWGSFALMGKAGPEFMAEREGVISDNGRDEQ

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P0XKT8

Antitoxin

Source ID Structure
AlphaFold DB A0A4P0XIS7

References