Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4668758..4669274 | Replicon | chromosome |
| Accession | NZ_LR890735 | ||
| Organism | Klebsiella pneumoniae isolate INF323-sc-2280125 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | JMX74_RS23010 | Protein ID | WP_134919476.1 |
| Coordinates | 4668758..4669042 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | JMX74_RS23015 | Protein ID | WP_101972099.1 |
| Coordinates | 4669032..4669274 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX74_RS22985 | 4664242..4664550 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
| JMX74_RS22990 | 4664635..4664808 | + | 174 | WP_019725541.1 | hypothetical protein | - |
| JMX74_RS22995 | 4664811..4665554 | + | 744 | WP_117030717.1 | MurR/RpiR family transcriptional regulator | - |
| JMX74_RS23000 | 4665911..4668049 | + | 2139 | WP_032446556.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| JMX74_RS23005 | 4668290..4668754 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| JMX74_RS23010 | 4668758..4669042 | - | 285 | WP_134919476.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMX74_RS23015 | 4669032..4669274 | - | 243 | WP_101972099.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| JMX74_RS23020 | 4669352..4671262 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| JMX74_RS23025 | 4671285..4672439 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| JMX74_RS23030 | 4672506..4673246 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11168.03 Da Isoelectric Point: 10.3787
>T292004 WP_134919476.1 NZ_LR890735:c4669042-4668758 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKLGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKLGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|