Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4563418..4564228 | Replicon | chromosome |
Accession | NZ_LR890735 | ||
Organism | Klebsiella pneumoniae isolate INF323-sc-2280125 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | JMX74_RS22585 | Protein ID | WP_201720329.1 |
Coordinates | 4563418..4563951 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | JMX74_RS22590 | Protein ID | WP_002887278.1 |
Coordinates | 4563962..4564228 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX74_RS22580 | 4562249..4563370 | + | 1122 | WP_201720328.1 | cupin domain-containing protein | - |
JMX74_RS22585 | 4563418..4563951 | - | 534 | WP_201720329.1 | GNAT family N-acetyltransferase | Toxin |
JMX74_RS22590 | 4563962..4564228 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
JMX74_RS22595 | 4564331..4565764 | - | 1434 | WP_201720330.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
JMX74_RS22600 | 4565754..4566437 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
JMX74_RS22605 | 4566609..4567994 | + | 1386 | WP_201720331.1 | efflux transporter outer membrane subunit | - |
JMX74_RS22610 | 4568012..4568356 | + | 345 | WP_021462623.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19798.67 Da Isoelectric Point: 5.2612
>T292003 WP_201720329.1 NZ_LR890735:c4563951-4563418 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGCIQLMDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGCIQLMDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|