Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 3151417..3152048 | Replicon | chromosome |
| Accession | NZ_LR890735 | ||
| Organism | Klebsiella pneumoniae isolate INF323-sc-2280125 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | JMX74_RS15890 | Protein ID | WP_012542177.1 |
| Coordinates | 3151872..3152048 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
| Locus tag | JMX74_RS15885 | Protein ID | WP_017898984.1 |
| Coordinates | 3151417..3151824 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX74_RS15845 | 3148038..3148472 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
| JMX74_RS15850 | 3148722..3149153 | - | 432 | WP_017898991.1 | hypothetical protein | - |
| JMX74_RS15855 | 3149150..3149467 | - | 318 | WP_020803188.1 | hypothetical protein | - |
| JMX74_RS15860 | 3149419..3149781 | - | 363 | WP_072071504.1 | HNH endonuclease | - |
| JMX74_RS15865 | 3149765..3149926 | - | 162 | WP_201720172.1 | hypothetical protein | - |
| JMX74_RS15870 | 3150008..3150484 | - | 477 | WP_048256784.1 | DUF2514 domain-containing protein | - |
| JMX74_RS15875 | 3150517..3151047 | - | 531 | WP_048256749.1 | lysozyme | - |
| JMX74_RS15880 | 3151025..3151261 | - | 237 | WP_004111739.1 | class II holin family protein | - |
| JMX74_RS15885 | 3151417..3151824 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| JMX74_RS15890 | 3151872..3152048 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| JMX74_RS15895 | 3152538..3154196 | + | 1659 | WP_072071506.1 | ATP-binding protein | - |
| JMX74_RS15900 | 3154216..3155250 | + | 1035 | WP_072071505.1 | DNA cytosine methyltransferase | - |
| JMX74_RS15905 | 3155275..3155616 | - | 342 | WP_201720173.1 | antitermination protein | - |
| JMX74_RS15910 | 3155629..3156660 | - | 1032 | WP_048256745.1 | DUF968 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3120517..3177469 | 56952 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T292000 WP_012542177.1 NZ_LR890735:c3152048-3151872 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT292000 WP_017898984.1 NZ_LR890735:c3151824-3151417 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q9U6R4 |