Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 69456..70030 | Replicon | plasmid 4 |
Accession | NZ_LR890729 | ||
Organism | Klebsiella pneumoniae isolate INF102-sc-2279897 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JMX38_RS27355 | Protein ID | WP_114262465.1 |
Coordinates | 69456..69779 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JMX38_RS27360 | Protein ID | WP_049140176.1 |
Coordinates | 69779..70030 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX38_RS27330 | 64907..66943 | - | 2037 | WP_201553246.1 | VWA domain-containing protein | - |
JMX38_RS27335 | 67028..67249 | - | 222 | WP_049140180.1 | hypothetical protein | - |
JMX38_RS27340 | 67588..67968 | + | 381 | WP_053093557.1 | hypothetical protein | - |
JMX38_RS27345 | 67958..68980 | - | 1023 | WP_049140179.1 | site-specific integrase | - |
JMX38_RS27350 | 69107..69466 | - | 360 | WP_087804770.1 | hypothetical protein | - |
JMX38_RS27355 | 69456..69779 | - | 324 | WP_114262465.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX38_RS27360 | 69779..70030 | - | 252 | WP_049140176.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JMX38_RS27365 | 70149..70397 | - | 249 | WP_087804766.1 | glutaredoxin | - |
JMX38_RS27370 | 70632..70877 | - | 246 | WP_095725670.1 | hypothetical protein | - |
JMX38_RS27375 | 70874..71338 | - | 465 | WP_095725734.1 | DUF2829 domain-containing protein | - |
JMX38_RS27380 | 71430..72185 | - | 756 | WP_201553248.1 | phosphate starvation-inducible protein PhoH | - |
JMX38_RS27385 | 72265..73086 | - | 822 | WP_201553250.1 | Dam family site-specific DNA-(adenine-N6)-methyltransferase | - |
JMX38_RS27390 | 73258..73869 | - | 612 | WP_049140159.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..103830 | 103830 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12467.39 Da Isoelectric Point: 10.0743
>T291991 WP_114262465.1 NZ_LR890729:c69779-69456 [Klebsiella pneumoniae]
MSDNFTTKLTFKRLALAEWESLSTPIRDKFKKVLAKRLESLDSLTMPKNRLSLQHNCYKIKLKNDGYRLAYTVKNDESGT
VTVVVTVVAVDRRDEIYNELKKRLNDE
MSDNFTTKLTFKRLALAEWESLSTPIRDKFKKVLAKRLESLDSLTMPKNRLSLQHNCYKIKLKNDGYRLAYTVKNDESGT
VTVVVTVVAVDRRDEIYNELKKRLNDE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|