Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3948530..3949149 | Replicon | chromosome |
Accession | NZ_LR890726 | ||
Organism | Klebsiella pneumoniae isolate INF102-sc-2279897 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | JMX38_RS19455 | Protein ID | WP_002892050.1 |
Coordinates | 3948931..3949149 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | JMX38_RS19450 | Protein ID | WP_002892066.1 |
Coordinates | 3948530..3948904 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX38_RS19440 | 3943682..3944875 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
JMX38_RS19445 | 3944898..3948044 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
JMX38_RS19450 | 3948530..3948904 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
JMX38_RS19455 | 3948931..3949149 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
JMX38_RS19460 | 3949308..3949874 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
JMX38_RS19465 | 3949846..3949986 | - | 141 | WP_064147182.1 | hypothetical protein | - |
JMX38_RS19470 | 3950007..3950477 | + | 471 | WP_002892026.1 | YlaC family protein | - |
JMX38_RS19475 | 3950452..3951903 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
JMX38_RS19480 | 3952004..3952702 | + | 699 | WP_002892021.1 | GNAT family N-acetyltransferase | - |
JMX38_RS19485 | 3952699..3952839 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
JMX38_RS19490 | 3952839..3953102 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T291987 WP_002892050.1 NZ_LR890726:3948931-3949149 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT291987 WP_002892066.1 NZ_LR890726:3948530-3948904 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |