Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3948530..3949149 Replicon chromosome
Accession NZ_LR890726
Organism Klebsiella pneumoniae isolate INF102-sc-2279897

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMX38_RS19455 Protein ID WP_002892050.1
Coordinates 3948931..3949149 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMX38_RS19450 Protein ID WP_002892066.1
Coordinates 3948530..3948904 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX38_RS19440 3943682..3944875 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMX38_RS19445 3944898..3948044 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMX38_RS19450 3948530..3948904 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMX38_RS19455 3948931..3949149 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMX38_RS19460 3949308..3949874 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMX38_RS19465 3949846..3949986 - 141 WP_064147182.1 hypothetical protein -
JMX38_RS19470 3950007..3950477 + 471 WP_002892026.1 YlaC family protein -
JMX38_RS19475 3950452..3951903 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMX38_RS19480 3952004..3952702 + 699 WP_002892021.1 GNAT family N-acetyltransferase -
JMX38_RS19485 3952699..3952839 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMX38_RS19490 3952839..3953102 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291987 WP_002892050.1 NZ_LR890726:3948931-3949149 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291987 WP_002892066.1 NZ_LR890726:3948530-3948904 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References