Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/UPF0150(antitoxin)
Location 3129379..3130010 Replicon chromosome
Accession NZ_LR890726
Organism Klebsiella pneumoniae isolate INF102-sc-2279897

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag JMX38_RS15600 Protein ID WP_012542177.1
Coordinates 3129834..3130010 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2X1QFN9
Locus tag JMX38_RS15595 Protein ID WP_012542176.1
Coordinates 3129379..3129786 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX38_RS15570 3124888..3125109 - 222 WP_032439852.1 hypothetical protein -
JMX38_RS15575 3125481..3126449 - 969 WP_000654814.1 IS5 family transposase -
JMX38_RS15580 3127551..3127901 - 351 WP_017898986.1 hypothetical protein -
JMX38_RS15585 3127898..3128395 - 498 WP_064168834.1 lysozyme -
JMX38_RS15590 3128373..3128642 - 270 WP_032439907.1 holin -
JMX38_RS15595 3129379..3129786 - 408 WP_012542176.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
JMX38_RS15600 3129834..3130010 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
JMX38_RS15605 3130375..3130539 + 165 WP_191742101.1 hypothetical protein -
JMX38_RS15610 3130578..3131558 - 981 WP_009310076.1 IS5-like element ISKpn26 family transposase -
JMX38_RS15615 3131584..3132720 + 1137 WP_201552985.1 nucleoid-associated protein -
JMX38_RS15620 3132710..3133936 + 1227 WP_064147745.1 hypothetical protein -
JMX38_RS15625 3133931..3134275 - 345 WP_064147746.1 antitermination protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3095154..3153358 58204
- inside IScluster/Tn - - 3125481..3131558 6077


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T291986 WP_012542177.1 NZ_LR890726:c3130010-3129834 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14977.99 Da        Isoelectric Point: 4.4277

>AT291986 WP_012542176.1 NZ_LR890726:c3129786-3129379 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARMINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A2X1QFN9

References