Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 208309..209048 | Replicon | chromosome |
Accession | NZ_LR890726 | ||
Organism | Klebsiella pneumoniae isolate INF102-sc-2279897 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | JMX38_RS01035 | Protein ID | WP_021312536.1 |
Coordinates | 208563..209048 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | JMX38_RS01030 | Protein ID | WP_003026799.1 |
Coordinates | 208309..208575 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX38_RS01015 | 203813..205882 | + | 2070 | WP_002922127.1 | glycine--tRNA ligase subunit beta | - |
JMX38_RS01020 | 206178..207547 | + | 1370 | WP_087661561.1 | IS3 family transposase | - |
JMX38_RS01025 | 207748..208176 | + | 429 | WP_004901287.1 | GFA family protein | - |
JMX38_RS01030 | 208309..208575 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
JMX38_RS01035 | 208563..209048 | + | 486 | WP_021312536.1 | GNAT family N-acetyltransferase | Toxin |
JMX38_RS01040 | 209373..210419 | - | 1047 | WP_004173931.1 | IS481-like element ISKpn28 family transposase | - |
JMX38_RS01045 | 210493..210645 | + | 153 | WP_002922102.1 | type I toxin-antitoxin system toxin HokA | - |
JMX38_RS01050 | 210724..211836 | + | 1113 | WP_001300563.1 | IS4-like element IS421 family transposase | - |
JMX38_RS01055 | 212296..213915 | + | 1620 | WP_064147680.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 206822..211999 | 5177 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17608.39 Da Isoelectric Point: 10.3370
>T291978 WP_021312536.1 NZ_LR890726:208563-209048 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|