Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 63398..63999 | Replicon | plasmid 3 |
| Accession | NZ_LR890724 | ||
| Organism | Klebsiella pneumoniae isolate KSB1_1H | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9Z1Q0 |
| Locus tag | JMW72_RS26710 | Protein ID | WP_001216047.1 |
| Coordinates | 63398..63778 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | JMW72_RS26715 | Protein ID | WP_001190712.1 |
| Coordinates | 63778..63999 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW72_RS26685 | 58838..60322 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
| JMW72_RS26690 | 60322..61515 | - | 1194 | WP_000219604.1 | terminase | - |
| JMW72_RS26695 | 61602..62054 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
| JMW72_RS26700 | 62143..63186 | - | 1044 | WP_023351456.1 | DUF968 domain-containing protein | - |
| JMW72_RS26705 | 63214..63393 | - | 180 | WP_000113019.1 | hypothetical protein | - |
| JMW72_RS26710 | 63398..63778 | - | 381 | WP_001216047.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| JMW72_RS26715 | 63778..63999 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JMW72_RS26720 | 64072..64461 | - | 390 | WP_000506726.1 | DNA repair protein | - |
| JMW72_RS26725 | 64585..64836 | - | 252 | WP_001283837.1 | DNA polymerase III subunit theta | - |
| JMW72_RS26730 | 65010..65219 | + | 210 | WP_001344848.1 | hypothetical protein | - |
| JMW72_RS26735 | 65204..65488 | - | 285 | WP_001142394.1 | hypothetical protein | - |
| JMW72_RS26740 | 65472..66152 | - | 681 | WP_023351458.1 | hypothetical protein | - |
| JMW72_RS26745 | 66134..66508 | - | 375 | WP_000988652.1 | hypothetical protein | - |
| JMW72_RS26750 | 66515..66808 | - | 294 | WP_000267998.1 | hypothetical protein | - |
| JMW72_RS26755 | 66832..67113 | - | 282 | WP_000002126.1 | ASCH domain-containing protein | - |
| JMW72_RS26760 | 67113..67373 | - | 261 | WP_000969524.1 | hypothetical protein | - |
| JMW72_RS26765 | 67370..67909 | - | 540 | WP_023351701.1 | DUF551 domain-containing protein | - |
| JMW72_RS26770 | 67906..68421 | - | 516 | WP_001229210.1 | hypothetical protein | - |
| JMW72_RS26775 | 68423..68611 | - | 189 | WP_000797279.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..95815 | 95815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13574.27 Da Isoelectric Point: 5.1514
>T291977 WP_001216047.1 NZ_LR890724:c63778-63398 [Klebsiella pneumoniae]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9Z1Q0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |