Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Xre |
Location | 94944..95643 | Replicon | plasmid 2 |
Accession | NZ_LR890720 | ||
Organism | Klebsiella pneumoniae isolate INF161-sc-2280013 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | JMW82_RS25725 | Protein ID | WP_074193184.1 |
Coordinates | 95254..95643 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | JMW82_RS25720 | Protein ID | WP_201519678.1 |
Coordinates | 94944..95261 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW82_RS25690 | 90598..91221 | - | 624 | WP_201519677.1 | TetR/AcrR family transcriptional regulator | - |
JMW82_RS25695 | 91801..92025 | + | 225 | Protein_100 | hypothetical protein | - |
JMW82_RS25700 | 92101..92721 | + | 621 | WP_201519696.1 | TauD/TfdA family dioxygenase | - |
JMW82_RS25705 | 92757..93545 | + | 789 | WP_201519697.1 | TSUP family transporter | - |
JMW82_RS25710 | 93547..94119 | + | 573 | WP_064168490.1 | GNAT family N-acetyltransferase | - |
JMW82_RS25715 | 94301..94639 | + | 339 | WP_135687034.1 | cupin domain-containing protein | - |
JMW82_RS25720 | 94944..95261 | - | 318 | WP_201519678.1 | helix-turn-helix domain-containing protein | Antitoxin |
JMW82_RS25725 | 95254..95643 | - | 390 | WP_074193184.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW82_RS25730 | 95890..96990 | + | 1101 | WP_201519679.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
JMW82_RS25735 | 97195..97980 | - | 786 | Protein_108 | DUF4113 domain-containing protein | - |
JMW82_RS25740 | 97980..98315 | - | 336 | WP_201519680.1 | peptidase | - |
JMW82_RS25745 | 98405..98830 | + | 426 | Protein_110 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
JMW82_RS25750 | 98830..100101 | + | 1272 | Protein_111 | Y-family DNA polymerase | - |
JMW82_RS25755 | 100180..100248 | + | 69 | Protein_112 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..103373 | 103373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14243.40 Da Isoelectric Point: 4.9626
>T291960 WP_074193184.1 NZ_LR890720:c95643-95254 [Klebsiella pneumoniae]
VGVYLTPEFEEDRQSARISNAILCKAAKAIFSGLPGDPLGKFTYKKRLGLPGVGARDGARSIVFFNDGENVFFFDMYLKS
ALSKKKGRELEPDEIDAYCNIAKDFIAMSPAVIKQLLADKELIEVTCDD
VGVYLTPEFEEDRQSARISNAILCKAAKAIFSGLPGDPLGKFTYKKRLGLPGVGARDGARSIVFFNDGENVFFFDMYLKS
ALSKKKGRELEPDEIDAYCNIAKDFIAMSPAVIKQLLADKELIEVTCDD
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|