Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4545532..4546258 | Replicon | chromosome |
Accession | NZ_LR890719 | ||
Organism | Klebsiella pneumoniae isolate INF161-sc-2280013 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | JMW82_RS22185 | Protein ID | WP_135693494.1 |
Coordinates | 4545532..4545873 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | JMW82_RS22190 | Protein ID | WP_107357768.1 |
Coordinates | 4545908..4546258 (-) | Length | 117 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW82_RS22155 | 4540550..4540816 | + | 267 | WP_004178415.1 | hypothetical protein | - |
JMW82_RS22160 | 4540816..4541488 | + | 673 | Protein_4343 | DUF4400 domain-containing protein | - |
JMW82_RS22165 | 4541499..4542383 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
JMW82_RS22170 | 4542582..4542770 | - | 189 | Protein_4345 | transposase | - |
JMW82_RS22175 | 4542787..4543898 | - | 1112 | Protein_4346 | IS3 family transposase | - |
JMW82_RS22180 | 4544266..4545273 | - | 1008 | WP_107357766.1 | restriction endonuclease | - |
JMW82_RS22185 | 4545532..4545873 | - | 342 | WP_135693494.1 | TA system toxin CbtA family protein | Toxin |
JMW82_RS22190 | 4545908..4546258 | - | 351 | WP_107357768.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
JMW82_RS22195 | 4546279..4546500 | - | 222 | WP_107357769.1 | DUF987 domain-containing protein | - |
JMW82_RS22200 | 4546516..4546989 | - | 474 | WP_107357770.1 | DNA repair protein RadC | - |
JMW82_RS22205 | 4547060..4547881 | - | 822 | WP_167875900.1 | DUF945 domain-containing protein | - |
JMW82_RS22210 | 4547977..4548654 | - | 678 | WP_107357771.1 | hypothetical protein | - |
JMW82_RS22215 | 4548939..4549832 | - | 894 | WP_107357772.1 | 50S ribosome-binding GTPase | - |
JMW82_RS22220 | 4549931..4551028 | - | 1098 | WP_117109402.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4523478..4572699 | 49221 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12914.95 Da Isoelectric Point: 9.7241
>T291956 WP_135693494.1 NZ_LR890719:c4545873-4545532 [Klebsiella pneumoniae]
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKRHIEAGITLVDAVNFLLENYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MNTLPAINQRAVQTCLSPVVVWQMLLARLLEQHYGLTLNDTPFSDEAVIKRHIEAGITLVDAVNFLLENYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12974.90 Da Isoelectric Point: 6.6206
>AT291956 WP_107357768.1 NZ_LR890719:c4546258-4545908 [Klebsiella pneumoniae]
MSNKTLTVNDDTAEPWWGLSRNVIPCFGARLVQEGNRLHYLAGRASLTGQIHEADLLHLDQAFPVLLKQMELMLTCGELN
PRHQHCVTLYAKGLTCEADTLGSCGYVYIAIYPTQR
MSNKTLTVNDDTAEPWWGLSRNVIPCFGARLVQEGNRLHYLAGRASLTGQIHEADLLHLDQAFPVLLKQMELMLTCGELN
PRHQHCVTLYAKGLTCEADTLGSCGYVYIAIYPTQR
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|