Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3895173..3895792 Replicon chromosome
Accession NZ_LR890719
Organism Klebsiella pneumoniae isolate INF161-sc-2280013

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag JMW82_RS19025 Protein ID WP_002892050.1
Coordinates 3895574..3895792 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag JMW82_RS19020 Protein ID WP_002892066.1
Coordinates 3895173..3895547 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW82_RS19010 3890325..3891518 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
JMW82_RS19015 3891541..3894687 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
JMW82_RS19020 3895173..3895547 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
JMW82_RS19025 3895574..3895792 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
JMW82_RS19030 3895951..3896517 + 567 WP_002892030.1 maltose O-acetyltransferase -
JMW82_RS19035 3896489..3896629 - 141 WP_004147370.1 hypothetical protein -
JMW82_RS19040 3896650..3897120 + 471 WP_002892026.1 YlaC family protein -
JMW82_RS19045 3897095..3898546 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
JMW82_RS19050 3898647..3899345 + 699 WP_004177238.1 GNAT family N-acetyltransferase -
JMW82_RS19055 3899342..3899482 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
JMW82_RS19060 3899482..3899745 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T291954 WP_002892050.1 NZ_LR890719:3895574-3895792 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT291954 WP_002892066.1 NZ_LR890719:3895173-3895547 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References