Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4633534..4634129 | Replicon | chromosome |
Accession | NZ_LR890714 | ||
Organism | Escherichia coli isolate MSB1_6C-sc-2280315 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
Locus tag | JMW19_RS22115 | Protein ID | WP_019842229.1 |
Coordinates | 4633534..4633884 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | JMW19_RS22120 | Protein ID | WP_001223213.1 |
Coordinates | 4633878..4634129 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW19_RS22095 | 4628864..4629886 | - | 1023 | WP_001550507.1 | ABC transporter permease | - |
JMW19_RS22100 | 4629900..4631402 | - | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
JMW19_RS22105 | 4631534..4632490 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
JMW19_RS22110 | 4632800..4633330 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
JMW19_RS22115 | 4633534..4633884 | - | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
JMW19_RS22120 | 4633878..4634129 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
JMW19_RS22125 | 4634341..4634682 | - | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
JMW19_RS22130 | 4634685..4638464 | - | 3780 | WP_001550503.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T291943 WP_019842229.1 NZ_LR890714:c4633884-4633534 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NWK6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4JJX7 |