Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4510585..4511405 | Replicon | chromosome |
| Accession | NZ_LR890714 | ||
| Organism | Escherichia coli isolate MSB1_6C-sc-2280315 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | A0A0V9MKL8 |
| Locus tag | JMW19_RS21505 | Protein ID | WP_001550554.1 |
| Coordinates | 4510585..4510842 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | - |
| Locus tag | JMW19_RS21510 | Protein ID | WP_001519303.1 |
| Coordinates | 4510854..4511405 (+) | Length | 184 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW19_RS21485 | 4505871..4506977 | + | 1107 | WP_001519308.1 | N-acetylneuraminate epimerase | - |
| JMW19_RS21490 | 4507042..4508022 | + | 981 | WP_001519307.1 | transposase | - |
| JMW19_RS21495 | 4508605..4509846 | - | 1242 | Protein_4207 | DNA helicase | - |
| JMW19_RS21500 | 4509909..4510208 | + | 300 | WP_001519304.1 | GNAT family N-acetyltransferase | - |
| JMW19_RS21505 | 4510585..4510842 | + | 258 | WP_001550554.1 | hypothetical protein | Toxin |
| JMW19_RS21510 | 4510854..4511405 | + | 552 | WP_001519303.1 | N-acetyltransferase | Antitoxin |
| JMW19_RS21515 | 4511457..4511618 | + | 162 | WP_201523978.1 | hypothetical protein | - |
| JMW19_RS21520 | 4511655..4512203 | + | 549 | WP_001519301.1 | hypothetical protein | - |
| JMW19_RS21525 | 4512330..4512590 | + | 261 | WP_000084876.1 | hypothetical protein | - |
| JMW19_RS21530 | 4512628..4512744 | + | 117 | Protein_4214 | VOC family protein | - |
| JMW19_RS21535 | 4512989..4514110 | + | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
| JMW19_RS21540 | 4514107..4514385 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
| JMW19_RS21545 | 4514397..4515710 | + | 1314 | WP_001519300.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE / fimB | 4501995..4511618 | 9623 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9744.33 Da Isoelectric Point: 11.0090
>T291941 WP_001550554.1 NZ_LR890714:4510585-4510842 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKPVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKPVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20463.61 Da Isoelectric Point: 6.8758
>AT291941 WP_001519303.1 NZ_LR890714:4510854-4511405 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCAQALMKPEHWRE
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|