Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4169910..4170663 Replicon chromosome
Accession NZ_LR890714
Organism Escherichia coli isolate MSB1_6C-sc-2280315

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag JMW19_RS19890 Protein ID WP_040064419.1
Coordinates 4170286..4170663 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag JMW19_RS19885 Protein ID WP_172803453.1
Coordinates 4169910..4170236 (+) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW19_RS19835 4165141..4165290 + 150 WP_001458941.1 hypothetical protein -
JMW19_RS19840 4165302..4165517 + 216 WP_040064431.1 hypothetical protein -
JMW19_RS19845 4165662..4166072 + 411 WP_060615797.1 hypothetical protein -
JMW19_RS19850 4166138..4167076 + 939 WP_077870123.1 hypothetical protein -
JMW19_RS19855 4167150..4167383 + 234 WP_040064428.1 DUF905 domain-containing protein -
JMW19_RS19860 4167494..4168315 + 822 WP_077870124.1 DUF945 domain-containing protein -
JMW19_RS19865 4168315..4168569 + 255 WP_060615795.1 hypothetical protein -
JMW19_RS19870 4168665..4169132 + 468 WP_040064426.1 antirestriction protein -
JMW19_RS19875 4169143..4169622 + 480 WP_040064425.1 DNA repair protein RadC -
JMW19_RS19880 4169633..4169854 + 222 WP_060615794.1 DUF987 family protein -
JMW19_RS19885 4169910..4170236 + 327 WP_172803453.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
JMW19_RS19890 4170286..4170663 + 378 WP_040064419.1 TA system toxin CbtA family protein Toxin
JMW19_RS19895 4170660..4171151 + 492 WP_060615793.1 hypothetical protein -
JMW19_RS19900 4171181..4171384 + 204 WP_040064417.1 DUF957 domain-containing protein -
JMW19_RS19905 4171465..4172316 + 852 WP_060615792.1 DUF4942 domain-containing protein -
JMW19_RS19915 4172647..4173378 - 732 WP_001308374.1 DNA polymerase III subunit epsilon -
JMW19_RS19920 4173443..4173910 + 468 WP_000917883.1 ribonuclease HI -
JMW19_RS19925 4173907..4174629 - 723 WP_001308373.1 class I SAM-dependent methyltransferase -
JMW19_RS19930 4174663..4175418 + 756 WP_001052732.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(4-103)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14092.01 Da        Isoelectric Point: 8.1110

>T291939 WP_040064419.1 NZ_LR890714:4170286-4170663 [Escherichia coli]
MQTQPAPPKREVSPRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDSVIHEHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SAETHSPLLTSIDILRARKATGLMTRNGYKVVTDITTGKYRGVQQ

Download         Length: 378 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 12197.90 Da        Isoelectric Point: 6.9559

>AT291939 WP_172803453.1 NZ_LR890714:4169910-4170236 [Escherichia coli]
IAEPWWGLKRNITPCFGARLVQEGNRLHYLNDRASITGRFSDADLRHLDQAFPLLLKQLELMLTSGELNPRHQHCVTLYA
KGLTCESDTLGSHGYVYLAIYPTPATTE

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References