Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2735267..2735905 | Replicon | chromosome |
Accession | NZ_LR890714 | ||
Organism | Escherichia coli isolate MSB1_6C-sc-2280315 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
Locus tag | JMW19_RS12950 | Protein ID | WP_000813795.1 |
Coordinates | 2735729..2735905 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | JMW19_RS12945 | Protein ID | WP_076797675.1 |
Coordinates | 2735267..2735683 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW19_RS12925 | 2730419..2731360 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
JMW19_RS12930 | 2731361..2732374 | - | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
JMW19_RS12935 | 2732392..2733537 | - | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
JMW19_RS12940 | 2733782..2735188 | - | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
JMW19_RS12945 | 2735267..2735683 | - | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
JMW19_RS12950 | 2735729..2735905 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
JMW19_RS12955 | 2736127..2736357 | + | 231 | WP_023910283.1 | YncJ family protein | - |
JMW19_RS12960 | 2736449..2738410 | - | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
JMW19_RS12965 | 2738483..2739019 | - | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
JMW19_RS12970 | 2739072..2740283 | + | 1212 | WP_071591517.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T291933 WP_000813795.1 NZ_LR890714:c2735905-2735729 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT291933 WP_076797675.1 NZ_LR890714:c2735683-2735267 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|