Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1221528..1222111 | Replicon | chromosome |
Accession | NZ_LR890714 | ||
Organism | Escherichia coli isolate MSB1_6C-sc-2280315 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | JMW19_RS05840 | Protein ID | WP_000254738.1 |
Coordinates | 1221776..1222111 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | JMW19_RS05835 | Protein ID | WP_000581937.1 |
Coordinates | 1221528..1221776 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW19_RS05825 | 1217867..1219168 | + | 1302 | WP_001551563.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
JMW19_RS05830 | 1219216..1221450 | + | 2235 | WP_001551562.1 | GTP diphosphokinase | - |
JMW19_RS05835 | 1221528..1221776 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
JMW19_RS05840 | 1221776..1222111 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
JMW19_RS05845 | 1222183..1222974 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
JMW19_RS05850 | 1223202..1224839 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
JMW19_RS05855 | 1224927..1226225 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T291926 WP_000254738.1 NZ_LR890714:1221776-1222111 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|