Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 877917..878749 | Replicon | chromosome |
| Accession | NZ_LR890714 | ||
| Organism | Escherichia coli isolate MSB1_6C-sc-2280315 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | JMW19_RS04160 | Protein ID | WP_000854753.1 |
| Coordinates | 877917..878291 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | JMW19_RS04165 | Protein ID | WP_001540478.1 |
| Coordinates | 878381..878749 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW19_RS04130 | 873030..874178 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| JMW19_RS04135 | 874250..875233 | - | 984 | WP_024946586.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| JMW19_RS04140 | 876044..876199 | - | 156 | WP_000729638.1 | hypothetical protein | - |
| JMW19_RS04145 | 876557..877126 | - | 570 | WP_001560692.1 | DUF4942 domain-containing protein | - |
| JMW19_RS04150 | 877223..877420 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| JMW19_RS04155 | 877432..877920 | - | 489 | WP_000777545.1 | hypothetical protein | - |
| JMW19_RS04160 | 877917..878291 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| JMW19_RS04165 | 878381..878749 | - | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMW19_RS04170 | 878912..879133 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| JMW19_RS04175 | 879196..879672 | - | 477 | WP_001313574.1 | RadC family protein | - |
| JMW19_RS04180 | 879688..880173 | - | 486 | WP_000214398.1 | antirestriction protein | - |
| JMW19_RS04185 | 880264..881082 | - | 819 | WP_001234682.1 | DUF945 domain-containing protein | - |
| JMW19_RS04190 | 881172..881405 | - | 234 | WP_001278283.1 | DUF905 family protein | - |
| JMW19_RS04195 | 881411..882088 | - | 678 | WP_001596606.1 | hypothetical protein | - |
| JMW19_RS04200 | 882239..882919 | - | 681 | WP_001278649.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 876044..876199 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T291923 WP_000854753.1 NZ_LR890714:c878291-877917 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT291923 WP_001540478.1 NZ_LR890714:c878749-878381 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |